| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
| Protein automated matches [196909] (83 species) not a true protein |
| Species Zoogloea ramigera [TaxId:350] [231413] (6 PDB entries) |
| Domain d2wkvc2: 2wkv C:269-392 [238963] Other proteins in same PDB: d2wkva1, d2wkvb1, d2wkvc1, d2wkvd1 automated match to d2wkva2 complexed with coa, na, so4; mutant |
PDB Entry: 2wkv (more details), 2.5 Å
SCOPe Domain Sequences for d2wkvc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wkvc2 c.95.1.0 (C:269-392) automated matches {Zoogloea ramigera [TaxId: 350]}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveadeafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl
Timeline for d2wkvc2: