Lineage for d2wkvc2 (2wkv C:269-392)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488301Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2488302Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2489065Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2489066Protein automated matches [196909] (62 species)
    not a true protein
  7. 2489885Species Zoogloea ramigera [TaxId:350] [231413] (6 PDB entries)
  8. 2489904Domain d2wkvc2: 2wkv C:269-392 [238963]
    Other proteins in same PDB: d2wkva1, d2wkvb1, d2wkvc1, d2wkvd1
    automated match to d2wkva2
    complexed with coa, na, so4; mutant

Details for d2wkvc2

PDB Entry: 2wkv (more details), 2.5 Å

PDB Description: biosynthetic thiolase from z. ramigera. complex of the n316d mutant with coenzyme a.
PDB Compounds: (C:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d2wkvc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wkvc2 c.95.1.0 (C:269-392) automated matches {Zoogloea ramigera [TaxId: 350]}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveadeafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl

SCOPe Domain Coordinates for d2wkvc2:

Click to download the PDB-style file with coordinates for d2wkvc2.
(The format of our PDB-style files is described here.)

Timeline for d2wkvc2: