Lineage for d2wkud1 (2wku D:4-268)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2164457Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2164458Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2164459Family c.95.1.1: Thiolase-related [53902] (10 proteins)
  6. 2164877Protein automated matches [231410] (2 species)
    not a true protein
  7. 2164911Species Zoogloea ramigera [TaxId:350] [231411] (6 PDB entries)
  8. 2164927Domain d2wkud1: 2wku D:4-268 [238960]
    Other proteins in same PDB: d2wkua2, d2wkub2, d2wkuc2, d2wkud2
    automated match to d2wkua1
    complexed with dno, so4; mutant

Details for d2wkud1

PDB Entry: 2wku (more details), 2.3 Å

PDB Description: biosynthetic thiolase from z. ramigera. the n316h mutant.
PDB Compounds: (D:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d2wkud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wkud1 c.95.1.1 (D:4-268) automated matches {Zoogloea ramigera [TaxId: 350]}
siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
gnasglndgaaaallmseaeasrrg

SCOPe Domain Coordinates for d2wkud1:

Click to download the PDB-style file with coordinates for d2wkud1.
(The format of our PDB-style files is described here.)

Timeline for d2wkud1: