SCOPe 2.08: Domain d1sppa_: 1spp A:

Lineage for d1sppa_ (1spp A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.23: CUB-like [49853] (3 superfamilies)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families)
   automatically mapped to Pfam PF00431

5. Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins)

6. Protein Major seminal plasma glycoprotein PSP-I [49858] (1 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [49859] (1 PDB entry)

8. Domain d1sppa_: 1spp A: [23896]
   Other proteins in same PDB: d1sppb_

Details for d1sppa_

PDB Entry: 1spp, 2.4 Å

PDB Description: the crystal structures of two members of the spermadhesin family reveal the folding of the cub domain

PDB Compounds: (A:) major seminal plasma glycoprotein psp-I

SCOPe Domain Sequences for d1sppa_:

Sequence; same for both SEQRES and ATOM records:

>d1sppa_ b.23.1.1 (A:) Major seminal plasma glycoprotein PSP-I {Pig (Sus scrofa) [TaxId: 9823]}
ldyhacggrltddygtiftykgpktecvwtlqvdpkykllvsiptlnltcgkeyvevleg
apgskslgkfceglsilnrgssgmtvkykrdsghpaspyeiiflrdsqg

Timeline for d1sppa_:

• d1sppa_ first appeared (with stable ids) in SCOP 1.55
  
• d1sppa_ appears in SCOPe 2.07