| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
| Protein automated matches [196909] (83 species) not a true protein |
| Species Zoogloea ramigera [TaxId:350] [231413] (6 PDB entries) |
| Domain d2wkuc2: 2wku C:269-392 [238959] Other proteins in same PDB: d2wkua1, d2wkub1, d2wkuc1, d2wkud1 automated match to d2wkua2 complexed with dno, so4; mutant |
PDB Entry: 2wku (more details), 2.3 Å
SCOPe Domain Sequences for d2wkuc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wkuc2 c.95.1.0 (C:269-392) automated matches {Zoogloea ramigera [TaxId: 350]}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaheafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl
Timeline for d2wkuc2: