Lineage for d1sfpa_ (1sfp A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777703Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777704Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) (S)
    automatically mapped to Pfam PF00431
  5. 2777705Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins)
  6. 2777706Protein Acidic seminal fluid protein (ASFP) [49856] (1 species)
  7. 2777707Species Cow (Bos taurus) [TaxId:9913] [49857] (1 PDB entry)
  8. 2777708Domain d1sfpa_: 1sfp A: [23895]

Details for d1sfpa_

PDB Entry: 1sfp (more details), 1.9 Å

PDB Description: crystal structure of acidic seminal fluid protein (asfp) at 1.9 a resolution: a bovine polypeptide from the spermadhesin family
PDB Compounds: (A:) asfp

SCOPe Domain Sequences for d1sfpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfpa_ b.23.1.1 (A:) Acidic seminal fluid protein (ASFP) {Cow (Bos taurus) [TaxId: 9913]}
lprntncggilkeesgviatyygpktncvwtiqmppeyhvrvsiqylqlncnkesleiid
glpgspvlgkicegslmdyrssgsimtvkyirepehpasfyevlyfqdpqa

SCOPe Domain Coordinates for d1sfpa_:

Click to download the PDB-style file with coordinates for d1sfpa_.
(The format of our PDB-style files is described here.)

Timeline for d1sfpa_: