| Class b: All beta proteins [48724] (180 folds) |
| Fold b.23: CUB-like [49853] (3 superfamilies) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) ![]() automatically mapped to Pfam PF00431 |
| Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins) |
| Protein Acidic seminal fluid protein (ASFP) [49856] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [49857] (1 PDB entry) |
| Domain d1sfpa_: 1sfp A: [23895] |
PDB Entry: 1sfp (more details), 1.9 Å
SCOPe Domain Sequences for d1sfpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sfpa_ b.23.1.1 (A:) Acidic seminal fluid protein (ASFP) {Cow (Bos taurus) [TaxId: 9913]}
lprntncggilkeesgviatyygpktncvwtiqmppeyhvrvsiqylqlncnkesleiid
glpgspvlgkicegslmdyrssgsimtvkyirepehpasfyevlyfqdpqa
Timeline for d1sfpa_: