Lineage for d2wgff2 (2wgf F:260-416)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1626713Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1626714Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1627417Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1627418Protein automated matches [196909] (45 species)
    not a true protein
  7. 1627661Species Mycobacterium tuberculosis [TaxId:1773] [196910] (11 PDB entries)
  8. 1627701Domain d2wgff2: 2wgf F:260-416 [238945]
    automated match to d2wgfa2
    complexed with na, peg, pg4

Details for d2wgff2

PDB Entry: 2wgf (more details), 2.15 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis C171Q KasA variant
PDB Compounds: (F:) 3-oxoacyl-[acyl-carrier-protein] synthase 1

SCOPe Domain Sequences for d2wgff2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wgff2 c.95.1.0 (F:260-416) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
kplarllgagitsdafhmvapaadgvragramtrslelaglspadidhvnahgtatpigd
aaeanairvagcdqaavyapksalghsigavgalesvltvltlrdgvipptlnyetpdpe
idldvvageprygdyryavnnsfgfgghnvalafgry

SCOPe Domain Coordinates for d2wgff2:

Click to download the PDB-style file with coordinates for d2wgff2.
(The format of our PDB-style files is described here.)

Timeline for d2wgff2: