SCOPe 2.07: Domain d2wgff1: 2wgf F:2-259

Lineage for d2wgff1 (2wgf F:2-259)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (68 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [196910] (12 PDB entries)

8. Domain d2wgff1: 2wgf F:2-259 [238944]
   automated match to d2wgfa1
   complexed with na, peg, pg4

Details for d2wgff1

PDB Entry: 2wgf, 2.15 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis C171Q KasA variant

PDB Compounds: (F:) 3-oxoacyl-[acyl-carrier-protein] synthase 1

SCOPe Domain Sequences for d2wgff1:

Sequence; same for both SEQRES and ATOM records:

>d2wgff1 c.95.1.0 (F:2-259) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
sqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavkig
ghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggaer
ivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsaqssgseaiaha
wrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfge
agalmlieteehakarga

Timeline for d2wgff1:

• d2wgff1 first appeared in SCOPe 2.04
  
• d2wgff1 appears in SCOPe 2.06