![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [196910] (13 PDB entries) |
![]() | Domain d2wgfd2: 2wgf D:260-416 [238941] automated match to d2wgfa2 complexed with na, peg, pg4 |
PDB Entry: 2wgf (more details), 2.15 Å
SCOPe Domain Sequences for d2wgfd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wgfd2 c.95.1.0 (D:260-416) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} kplarllgagitsdafhmvapaadgvragramtrslelaglspadidhvnahgtatpigd aaeanairvagcdqaavyapksalghsigavgalesvltvltlrdgvipptlnyetpdpe idldvvageprygdyryavnnsfgfgghnvalafgry
Timeline for d2wgfd2: