Lineage for d1d2qa_ (1d2q A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662724Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 662725Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 662726Family b.22.1.1: TNF-like [49843] (13 proteins)
  6. 662751Protein Apoptosis-2 ligand, apo2l/TRAIL [49851] (1 species)
  7. 662752Species Human (Homo sapiens) [TaxId:9606] [49852] (5 PDB entries)
  8. 662764Domain d1d2qa_: 1d2q A: [23894]

Details for d1d2qa_

PDB Entry: 1d2q (more details), 2.8 Å

PDB Description: crystal structure of human trail
PDB Compounds: (A:) tnf-related apoptosis inducing ligand

SCOP Domain Sequences for d1d2qa_:

Sequence, based on SEQRES records: (download)

>d1d2qa_ b.22.1.1 (A:) Apoptosis-2 ligand, apo2l/TRAIL {Human (Homo sapiens) [TaxId: 9606]}
rvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrngelvihekg
fyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeygly
siyqggifelkendrifvsvtnehlidmdheasffgaflvg

Sequence, based on observed residues (ATOM records): (download)

>d1d2qa_ b.22.1.1 (A:) Apoptosis-2 ligand, apo2l/TRAIL {Human (Homo sapiens) [TaxId: 9606]}
rvaahitgtrgntlsknekalgrkinswessghsflsnlhlrngelvihekgfyyiysqt
yfrqmvqyiykytsypdpillmksarnscyglysiyqggifelkendrifvsvtnehaid
mdheasffgaflvg

SCOP Domain Coordinates for d1d2qa_:

Click to download the PDB-style file with coordinates for d1d2qa_.
(The format of our PDB-style files is described here.)

Timeline for d1d2qa_: