| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily) beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology |
Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) ![]() |
| Family d.240.1.0: automated matches [231323] (1 protein) not a true family |
| Protein automated matches [231324] (5 species) not a true protein |
| Species Sulfolobus solfataricus [TaxId:273057] [231327] (33 PDB entries) |
| Domain d2w9bb2: 2w9b B:241-342 [238937] Other proteins in same PDB: d2w9ba1, d2w9bb1, d2w9bb3 automated match to d2v4ra2 protein/DNA complex; complexed with mg |
PDB Entry: 2w9b (more details), 2.28 Å
SCOPe Domain Sequences for d2w9bb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w9bb2 d.240.1.0 (B:241-342) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfie
Timeline for d2w9bb2: