![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.68.4: TolB, C-terminal domain [50960] (2 families) ![]() |
![]() | Family b.68.4.1: TolB, C-terminal domain [50961] (2 proteins) |
![]() | Protein automated matches [232579] (3 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [232580] (2 PDB entries) |
![]() | Domain d2w8bf2: 2w8b F:162-430 [238935] Other proteins in same PDB: d2w8ba1, d2w8bb1, d2w8bc_, d2w8bd1, d2w8be1, d2w8be2, d2w8bf1, d2w8bg1, d2w8bg2, d2w8bh1, d2w8bh2 automated match to d2hqsb1 complexed with act, gol, so4 |
PDB Entry: 2w8b (more details), 1.86 Å
SCOPe Domain Sequences for d2w8bf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w8bf2 b.68.4.1 (F:162-430) automated matches {Escherichia coli [TaxId: 562]} afrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqplmspawspdgsklayvtfes grsalviqtlangavrqvasfprhngapafspdgsklafalsktgslnlyvmdlasgqir qvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvninggapqritwegsqnqdadvss dgkfmvmvssnggqqhiakqdlatggvqvlsstfldetpslapngtmviysssqgmgsvl nlvstdgrfkarlpatdgqvkfpawspyl
Timeline for d2w8bf2: