Lineage for d2w8bf1 (2w8b F:22-161)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1856157Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 1856309Superfamily c.51.2: TolB, N-terminal domain [52964] (2 families) (S)
  5. 1856323Family c.51.2.0: automated matches [232575] (1 protein)
    not a true family
  6. 1856324Protein automated matches [232576] (2 species)
    not a true protein
  7. 1856325Species Escherichia coli [TaxId:562] [232577] (2 PDB entries)
  8. 1856329Domain d2w8bf1: 2w8b F:22-161 [238934]
    Other proteins in same PDB: d2w8ba2, d2w8bb2, d2w8bc_, d2w8bd2, d2w8be_, d2w8bf2, d2w8bg_, d2w8bh_
    automated match to d2ivza2
    complexed with act, gol, so4

Details for d2w8bf1

PDB Entry: 2w8b (more details), 1.86 Å

PDB Description: crystal structure of processed tolb in complex with pal
PDB Compounds: (F:) protein tolb

SCOPe Domain Sequences for d2w8bf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w8bf1 c.51.2.0 (F:22-161) automated matches {Escherichia coli [TaxId: 562]}
evrividsgvdsgrpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpg
saqevqpaawsalgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwl
ryaghtasdevfekltgikg

SCOPe Domain Coordinates for d2w8bf1:

Click to download the PDB-style file with coordinates for d2w8bf1.
(The format of our PDB-style files is described here.)

Timeline for d2w8bf1: