SCOPe 2.06: Domain d2w8bd2: 2w8b D:162-430

Lineage for d2w8bd2 (2w8b D:162-430)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.4: TolB, C-terminal domain [50960] (1 family)

5. Family b.68.4.1: TolB, C-terminal domain [50961] (2 proteins)

6. Protein automated matches [232579] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [232580] (2 PDB entries)

8. Domain d2w8bd2: 2w8b D:162-430 [238933]
   Other proteins in same PDB: d2w8ba1, d2w8bb1, d2w8bc_, d2w8bd1, d2w8be1, d2w8be2, d2w8bf1, d2w8bg1, d2w8bg2, d2w8bh1, d2w8bh2
   automated match to d2hqsb1
   complexed with act, gol, so4

Details for d2w8bd2

PDB Entry: 2w8b, 1.86 Å

PDB Description: crystal structure of processed tolb in complex with pal

PDB Compounds: (D:) protein tolb

SCOPe Domain Sequences for d2w8bd2:

Sequence; same for both SEQRES and ATOM records:

>d2w8bd2 b.68.4.1 (D:162-430) automated matches {Escherichia coli [TaxId: 562]}
afrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqplmspawspdgsklayvtfes
grsalviqtlangavrqvasfprhngapafspdgsklafalsktgslnlyvmdlasgqir
qvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvninggapqritwegsqnqdadvss
dgkfmvmvssnggqqhiakqdlatggvqvlsstfldetpslapngtmviysssqgmgsvl
nlvstdgrfkarlpatdgqvkfpawspyl

Timeline for d2w8bd2:

• d2w8bd2 first appeared in SCOPe 2.04
  
• d2w8bd2 appears in SCOPe 2.05
  
• d2w8bd2 appears in SCOPe 2.07
  
• d2w8bd2 appears in the current release, SCOPe 2.08