Lineage for d2w8bd2 (2w8b D:162-430)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1802176Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1802773Superfamily b.68.4: TolB, C-terminal domain [50960] (1 family) (S)
  5. 1802774Family b.68.4.1: TolB, C-terminal domain [50961] (2 proteins)
  6. 1802787Protein automated matches [232579] (2 species)
    not a true protein
  7. 1802788Species Escherichia coli [TaxId:562] [232580] (2 PDB entries)
  8. 1802791Domain d2w8bd2: 2w8b D:162-430 [238933]
    Other proteins in same PDB: d2w8ba1, d2w8bb1, d2w8bc_, d2w8bd1, d2w8be_, d2w8bf1, d2w8bg_, d2w8bh_
    automated match to d2hqsb1
    complexed with act, gol, so4

Details for d2w8bd2

PDB Entry: 2w8b (more details), 1.86 Å

PDB Description: crystal structure of processed tolb in complex with pal
PDB Compounds: (D:) protein tolb

SCOPe Domain Sequences for d2w8bd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w8bd2 b.68.4.1 (D:162-430) automated matches {Escherichia coli [TaxId: 562]}
afrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqplmspawspdgsklayvtfes
grsalviqtlangavrqvasfprhngapafspdgsklafalsktgslnlyvmdlasgqir
qvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvninggapqritwegsqnqdadvss
dgkfmvmvssnggqqhiakqdlatggvqvlsstfldetpslapngtmviysssqgmgsvl
nlvstdgrfkarlpatdgqvkfpawspyl

SCOPe Domain Coordinates for d2w8bd2:

Click to download the PDB-style file with coordinates for d2w8bd2.
(The format of our PDB-style files is described here.)

Timeline for d2w8bd2: