SCOPe 2.07: Domain d2w8bd1: 2w8b D:22-161

Lineage for d2w8bd1 (2w8b D:22-161)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.2: TolB, N-terminal domain [52964] (2 families)

5. Family c.51.2.0: automated matches [232575] (1 protein)
   not a true family

6. Protein automated matches [232576] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [232577] (2 PDB entries)

8. Domain d2w8bd1: 2w8b D:22-161 [238932]
   Other proteins in same PDB: d2w8ba2, d2w8bb2, d2w8bc_, d2w8bd2, d2w8be1, d2w8be2, d2w8bf2, d2w8bg1, d2w8bg2, d2w8bh1, d2w8bh2
   automated match to d2ivza2
   complexed with act, gol, so4

Details for d2w8bd1

PDB Entry: 2w8b, 1.86 Å

PDB Description: crystal structure of processed tolb in complex with pal

PDB Compounds: (D:) protein tolb

SCOPe Domain Sequences for d2w8bd1:

Sequence; same for both SEQRES and ATOM records:

>d2w8bd1 c.51.2.0 (D:22-161) automated matches {Escherichia coli [TaxId: 562]}
evrividsgvdsgrpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpg
saqevqpaawsalgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwl
ryaghtasdevfekltgikg

Timeline for d2w8bd1:

• d2w8bd1 first appeared in SCOPe 2.04
  
• d2w8bd1 appears in SCOPe 2.06
  
• d2w8bd1 appears in the current release, SCOPe 2.08