| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.2: TolB, N-terminal domain [52964] (2 families) ![]() |
| Family c.51.2.0: automated matches [232575] (1 protein) not a true family |
| Protein automated matches [232576] (4 species) not a true protein |
| Species Escherichia coli [TaxId:562] [232577] (2 PDB entries) |
| Domain d2w8bb1: 2w8b B:22-161 [238930] Other proteins in same PDB: d2w8ba2, d2w8bb2, d2w8bc_, d2w8bd2, d2w8be1, d2w8be2, d2w8bf2, d2w8bg1, d2w8bg2, d2w8bh1, d2w8bh2 automated match to d2ivza2 complexed with act, gol, so4 |
PDB Entry: 2w8b (more details), 1.86 Å
SCOPe Domain Sequences for d2w8bb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w8bb1 c.51.2.0 (B:22-161) automated matches {Escherichia coli [TaxId: 562]}
evrividsgvdsgrpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpg
saqevqpaawsalgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwl
ryaghtasdevfekltgikg
Timeline for d2w8bb1: