SCOPe 2.06: Domain d2w3sg4: 2w3s G:346-462

Lineage for d2w3sg4 (2w3s G:346-462)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families)
   automatically mapped to Pfam PF03450

5. Family d.87.2.0: automated matches [232089] (1 protein)
   not a true family

6. Protein automated matches [232090] (4 species)
   not a true protein

7. Species Rhodobacter capsulatus [TaxId:1061] [255638] (2 PDB entries)

8. Domain d2w3sg4: 2w3s G:346-462 [238927]
   Other proteins in same PDB: d2w3sa1, d2w3sa2, d2w3sa3, d2w3sb1, d2w3sb2, d2w3sc1, d2w3sc2, d2w3sc3, d2w3sd1, d2w3sd2, d2w3se1, d2w3se2, d2w3se3, d2w3sf1, d2w3sf2, d2w3sg1, d2w3sg2, d2w3sg3, d2w3sh1, d2w3sh2
   automated match to d1jroa3
   complexed with ca, fad, fes, mom, mte, xan

Details for d2w3sg4

PDB Entry: 2w3s, 2.6 Å

PDB Description: crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with xanthine

PDB Compounds: (G:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d2w3sg4:

Sequence; same for both SEQRES and ATOM records:

>d2w3sg4 d.87.2.0 (G:346-462) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
pglrcyklskrfdqdisavcgclnltlkgskietariafggmagvpkraaafeaaligqd
fredtiaaalpllaqdftplsdmrasaayrmnaaqamalryvrelsgeavavlevmp

Timeline for d2w3sg4:

• d2w3sg4 first appeared in SCOPe 2.04
  
• d2w3sg4 appears in SCOPe 2.05
  
• d2w3sg4 appears in SCOPe 2.07
  
• d2w3sg4 appears in the current release, SCOPe 2.08