Lineage for d2w3sg4 (2w3s G:346-462)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962835Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2962998Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 2963058Family d.87.2.0: automated matches [232089] (1 protein)
    not a true family
  6. 2963059Protein automated matches [232090] (5 species)
    not a true protein
  7. 2963091Species Rhodobacter capsulatus [TaxId:1061] [255638] (2 PDB entries)
  8. 2963095Domain d2w3sg4: 2w3s G:346-462 [238927]
    Other proteins in same PDB: d2w3sa1, d2w3sa2, d2w3sa3, d2w3sb1, d2w3sb2, d2w3sc1, d2w3sc2, d2w3sc3, d2w3sd1, d2w3sd2, d2w3se1, d2w3se2, d2w3se3, d2w3sf1, d2w3sf2, d2w3sg1, d2w3sg2, d2w3sg3, d2w3sh1, d2w3sh2
    automated match to d1jroa3
    complexed with ca, fad, fes, mom, mte, xan

Details for d2w3sg4

PDB Entry: 2w3s (more details), 2.6 Å

PDB Description: crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with xanthine
PDB Compounds: (G:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d2w3sg4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w3sg4 d.87.2.0 (G:346-462) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
pglrcyklskrfdqdisavcgclnltlkgskietariafggmagvpkraaafeaaligqd
fredtiaaalpllaqdftplsdmrasaayrmnaaqamalryvrelsgeavavlevmp

SCOPe Domain Coordinates for d2w3sg4:

Click to download the PDB-style file with coordinates for d2w3sg4.
(The format of our PDB-style files is described here.)

Timeline for d2w3sg4: