Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) |
Family d.145.1.0: automated matches [191624] (1 protein) not a true family |
Protein automated matches [191143] (13 species) not a true protein |
Species Rhodobacter capsulatus [TaxId:1061] [255637] (2 PDB entries) |
Domain d2w3sg3: 2w3s G:179-345 [238926] Other proteins in same PDB: d2w3sa1, d2w3sa2, d2w3sa4, d2w3sb1, d2w3sb2, d2w3sc1, d2w3sc2, d2w3sc4, d2w3sd1, d2w3sd2, d2w3se1, d2w3se2, d2w3se4, d2w3sf1, d2w3sf2, d2w3sg1, d2w3sg2, d2w3sg4, d2w3sh1, d2w3sh2 automated match to d1jroa4 complexed with ca, fad, fes, mom, mte, xan |
PDB Entry: 2w3s (more details), 2.6 Å
SCOPe Domain Sequences for d2w3sg3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w3sg3 d.145.1.0 (G:179-345) automated matches {Rhodobacter capsulatus [TaxId: 1061]} paflpetsdaladwylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretp dgygigagvtiaalrafaegphpalagllrrfaseqvrqvatiggniangspigdgppal iamgasltlrrgqerrrmpledffleyrkqdrrpgefvesvtlpksa
Timeline for d2w3sg3: