Class a: All alpha proteins [46456] (290 folds) |
Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily) core: 4 helices, bundle |
Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) contains 2Fe-2S cluster |
Family a.56.1.0: automated matches [227241] (1 protein) not a true family |
Protein automated matches [227007] (6 species) not a true protein |
Species Rhodobacter capsulatus [TaxId:1061] [255636] (2 PDB entries) |
Domain d2w3sg2: 2w3s G:85-166 [238925] Other proteins in same PDB: d2w3sa1, d2w3sa3, d2w3sa4, d2w3sb1, d2w3sb2, d2w3sc1, d2w3sc3, d2w3sc4, d2w3sd1, d2w3sd2, d2w3se1, d2w3se3, d2w3se4, d2w3sf1, d2w3sf2, d2w3sg1, d2w3sg3, d2w3sg4, d2w3sh1, d2w3sh2 automated match to d1jroa1 complexed with ca, fad, fes, mom, mte, xan |
PDB Entry: 2w3s (more details), 2.6 Å
SCOPe Domain Sequences for d2w3sg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w3sg2 a.56.1.0 (G:85-166) automated matches {Rhodobacter capsulatus [TaxId: 1061]} dgrlhpvqqamidhhgsqcgfctpgfivsmaaahdrdrkdyddllagnlcrctgyapilr aaeaaageppadwlqadaaftl
Timeline for d2w3sg2: