![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
![]() | Protein automated matches [191164] (24 species) not a true protein |
![]() | Species Rhodobacter capsulatus [TaxId:1061] [255635] (2 PDB entries) |
![]() | Domain d2w3sg1: 2w3s G:1-84 [238924] Other proteins in same PDB: d2w3sa2, d2w3sa3, d2w3sa4, d2w3sb1, d2w3sb2, d2w3sc2, d2w3sc3, d2w3sc4, d2w3sd1, d2w3sd2, d2w3se2, d2w3se3, d2w3se4, d2w3sf1, d2w3sf2, d2w3sg2, d2w3sg3, d2w3sg4, d2w3sh1, d2w3sh2 automated match to d1jroa2 complexed with ca, fad, fes, mom, mte, xan |
PDB Entry: 2w3s (more details), 2.6 Å
SCOPe Domain Sequences for d2w3sg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w3sg1 d.15.4.0 (G:1-84) automated matches {Rhodobacter capsulatus [TaxId: 1061]} meiafllngetrrvriedptqsllewlraegltgtkegcnegdcgactvmirdaagsrav naclmmlpqiagkalrtiegiaap
Timeline for d2w3sg1: