Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) automatically mapped to Pfam PF03450 |
Family d.87.2.0: automated matches [232089] (1 protein) not a true family |
Protein automated matches [232090] (5 species) not a true protein |
Species Rhodobacter capsulatus [TaxId:1061] [255638] (2 PDB entries) |
Domain d2w3se4: 2w3s E:346-462 [238923] Other proteins in same PDB: d2w3sa1, d2w3sa2, d2w3sa3, d2w3sb1, d2w3sb2, d2w3sc1, d2w3sc2, d2w3sc3, d2w3sd1, d2w3sd2, d2w3se1, d2w3se2, d2w3se3, d2w3sf1, d2w3sf2, d2w3sg1, d2w3sg2, d2w3sg3, d2w3sh1, d2w3sh2 automated match to d1jroa3 complexed with ca, fad, fes, mom, mte, xan |
PDB Entry: 2w3s (more details), 2.6 Å
SCOPe Domain Sequences for d2w3se4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w3se4 d.87.2.0 (E:346-462) automated matches {Rhodobacter capsulatus [TaxId: 1061]} pglrcyklskrfdqdisavcgclnltlkgskietariafggmagvpkraaafeaaligqd fredtiaaalpllaqdftplsdmrasaayrmnaaqamalryvrelsgeavavlevmp
Timeline for d2w3se4: