SCOPe 2.07: Domain d2w3se2: 2w3s E:85-166

Lineage for d2w3se2 (2w3s E:85-166)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
   core: 4 helices, bundle

4. Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families)
   contains 2Fe-2S cluster

5. Family a.56.1.0: automated matches [227241] (1 protein)
   not a true family

6. Protein automated matches [227007] (6 species)
   not a true protein

7. Species Rhodobacter capsulatus [TaxId:1061] [255636] (2 PDB entries)

8. Domain d2w3se2: 2w3s E:85-166 [238921]
   Other proteins in same PDB: d2w3sa1, d2w3sa3, d2w3sa4, d2w3sb1, d2w3sb2, d2w3sc1, d2w3sc3, d2w3sc4, d2w3sd1, d2w3sd2, d2w3se1, d2w3se3, d2w3se4, d2w3sf1, d2w3sf2, d2w3sg1, d2w3sg3, d2w3sg4, d2w3sh1, d2w3sh2
   automated match to d1jroa1
   complexed with ca, fad, fes, mom, mte, xan

Details for d2w3se2

PDB Entry: 2w3s, 2.6 Å

PDB Description: crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with xanthine

PDB Compounds: (E:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d2w3se2:

Sequence; same for both SEQRES and ATOM records:

>d2w3se2 a.56.1.0 (E:85-166) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
dgrlhpvqqamidhhgsqcgfctpgfivsmaaahdrdrkdyddllagnlcrctgyapilr
aaeaaageppadwlqadaaftl

Timeline for d2w3se2:

• d2w3se2 first appeared in SCOPe 2.04
  
• d2w3se2 appears in SCOPe 2.06
  
• d2w3se2 appears in the current release, SCOPe 2.08