Lineage for d2w3sc1 (2w3s C:1-84)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179170Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2179555Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2179556Protein automated matches [191164] (21 species)
    not a true protein
  7. 2179630Species Rhodobacter capsulatus [TaxId:1061] [255635] (2 PDB entries)
  8. 2179632Domain d2w3sc1: 2w3s C:1-84 [238916]
    Other proteins in same PDB: d2w3sa2, d2w3sa3, d2w3sa4, d2w3sb1, d2w3sb2, d2w3sc2, d2w3sc3, d2w3sc4, d2w3sd1, d2w3sd2, d2w3se2, d2w3se3, d2w3se4, d2w3sf1, d2w3sf2, d2w3sg2, d2w3sg3, d2w3sg4, d2w3sh1, d2w3sh2
    automated match to d1jroa2
    complexed with ca, fad, fes, mom, mte, xan

Details for d2w3sc1

PDB Entry: 2w3s (more details), 2.6 Å

PDB Description: crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with xanthine
PDB Compounds: (C:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d2w3sc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w3sc1 d.15.4.0 (C:1-84) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
meiafllngetrrvriedptqsllewlraegltgtkegcnegdcgactvmirdaagsrav
naclmmlpqiagkalrtiegiaap

SCOPe Domain Coordinates for d2w3sc1:

Click to download the PDB-style file with coordinates for d2w3sc1.
(The format of our PDB-style files is described here.)

Timeline for d2w3sc1: