Lineage for d2w3sa3 (2w3s A:179-345)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1675721Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 1675722Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 1675950Family d.145.1.0: automated matches [191624] (1 protein)
    not a true family
  6. 1675951Protein automated matches [191143] (7 species)
    not a true protein
  7. 1675969Species Rhodobacter capsulatus [TaxId:1061] [255637] (2 PDB entries)
  8. 1675970Domain d2w3sa3: 2w3s A:179-345 [238914]
    Other proteins in same PDB: d2w3sa1, d2w3sa2, d2w3sa4, d2w3sb1, d2w3sb2, d2w3sc1, d2w3sc2, d2w3sc4, d2w3sd1, d2w3sd2, d2w3se1, d2w3se2, d2w3se4, d2w3sf1, d2w3sf2, d2w3sg1, d2w3sg2, d2w3sg4, d2w3sh1, d2w3sh2
    automated match to d1jroa4
    complexed with ca, fad, fes, mom, mpn, xan

Details for d2w3sa3

PDB Entry: 2w3s (more details), 2.6 Å

PDB Description: crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with xanthine
PDB Compounds: (A:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d2w3sa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w3sa3 d.145.1.0 (A:179-345) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
paflpetsdaladwylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretp
dgygigagvtiaalrafaegphpalagllrrfaseqvrqvatiggniangspigdgppal
iamgasltlrrgqerrrmpledffleyrkqdrrpgefvesvtlpksa

SCOPe Domain Coordinates for d2w3sa3:

Click to download the PDB-style file with coordinates for d2w3sa3.
(The format of our PDB-style files is described here.)

Timeline for d2w3sa3: