Lineage for d2w3sa2 (2w3s A:85-166)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328387Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2328388Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2328495Family a.56.1.0: automated matches [227241] (1 protein)
    not a true family
  6. 2328496Protein automated matches [227007] (6 species)
    not a true protein
  7. 2328507Species Rhodobacter capsulatus [TaxId:1061] [255636] (2 PDB entries)
  8. 2328508Domain d2w3sa2: 2w3s A:85-166 [238913]
    Other proteins in same PDB: d2w3sa1, d2w3sa3, d2w3sa4, d2w3sb1, d2w3sb2, d2w3sc1, d2w3sc3, d2w3sc4, d2w3sd1, d2w3sd2, d2w3se1, d2w3se3, d2w3se4, d2w3sf1, d2w3sf2, d2w3sg1, d2w3sg3, d2w3sg4, d2w3sh1, d2w3sh2
    automated match to d1jroa1
    complexed with ca, fad, fes, mom, mte, xan

Details for d2w3sa2

PDB Entry: 2w3s (more details), 2.6 Å

PDB Description: crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with xanthine
PDB Compounds: (A:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d2w3sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w3sa2 a.56.1.0 (A:85-166) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
dgrlhpvqqamidhhgsqcgfctpgfivsmaaahdrdrkdyddllagnlcrctgyapilr
aaeaaageppadwlqadaaftl

SCOPe Domain Coordinates for d2w3sa2:

Click to download the PDB-style file with coordinates for d2w3sa2.
(The format of our PDB-style files is described here.)

Timeline for d2w3sa2: