SCOPe 2.07: Domain d2w3re2: 2w3r E:85-166

Lineage for d2w3re2 (2w3r E:85-166)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
   core: 4 helices, bundle

4. Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families)
   contains 2Fe-2S cluster

5. Family a.56.1.0: automated matches [227241] (1 protein)
   not a true family

6. Protein automated matches [227007] (6 species)
   not a true protein

7. Species Rhodobacter capsulatus [TaxId:1061] [255636] (2 PDB entries)

8. Domain d2w3re2: 2w3r E:85-166 [238905]
   Other proteins in same PDB: d2w3ra1, d2w3ra3, d2w3ra4, d2w3rb1, d2w3rb2, d2w3rc1, d2w3rc3, d2w3rc4, d2w3rd1, d2w3rd2, d2w3re1, d2w3re3, d2w3re4, d2w3rf1, d2w3rf2, d2w3rg1, d2w3rg3, d2w3rg4, d2w3rh1, d2w3rh2
   automated match to d1jroa1
   complexed with ca, fad, fes, hpa, mom, mte

Details for d2w3re2

PDB Entry: 2w3r, 2.9 Å

PDB Description: crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with hypoxanthine

PDB Compounds: (E:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d2w3re2:

Sequence; same for both SEQRES and ATOM records:

>d2w3re2 a.56.1.0 (E:85-166) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
dgrlhpvqqamidhhgsqcgfctpgfivsmaaahdrdrkdyddllagnlcrctgyapilr
aaeaaageppadwlqadaaftl

Timeline for d2w3re2:

• d2w3re2 first appeared in SCOPe 2.04
  
• d2w3re2 appears in SCOPe 2.06
  
• d2w3re2 appears in the current release, SCOPe 2.08