SCOPe 2.04: Domain d2w3re1: 2w3r E:1-84

Lineage for d2w3re1 (2w3r E:1-84)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (13 species)
   not a true protein

7. Species Rhodobacter capsulatus [TaxId:1061] [255635] (2 PDB entries)

8. Domain d2w3re1: 2w3r E:1-84 [238904]
   Other proteins in same PDB: d2w3ra2, d2w3ra3, d2w3ra4, d2w3rb1, d2w3rb2, d2w3rc2, d2w3rc3, d2w3rc4, d2w3rd1, d2w3rd2, d2w3re2, d2w3re3, d2w3re4, d2w3rf1, d2w3rf2, d2w3rg2, d2w3rg3, d2w3rg4, d2w3rh1, d2w3rh2
   automated match to d1jroa2
   complexed with ca, fad, fes, hpa, mom, mpn

Details for d2w3re1

PDB Entry: 2w3r, 2.9 Å

PDB Description: crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with hypoxanthine

PDB Compounds: (E:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d2w3re1:

Sequence; same for both SEQRES and ATOM records:

>d2w3re1 d.15.4.0 (E:1-84) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
meiafllngetrrvriedptqsllewlraegltgtkegcnegdcgactvmirdaagsrav
naclmmlpqiagkalrtiegiaap

Timeline for d2w3re1:

• d2w3re1 is new in SCOPe 2.04-stable
  
• d2w3re1 appears in SCOPe 2.05
  
• d2w3re1 appears in the current release, SCOPe 2.08