![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
![]() | Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) ![]() automatically mapped to Pfam PF03450 |
![]() | Family d.87.2.0: automated matches [232089] (1 protein) not a true family |
![]() | Protein automated matches [232090] (4 species) not a true protein |
![]() | Species Rhodobacter capsulatus [TaxId:1061] [255638] (2 PDB entries) |
![]() | Domain d2w3rc4: 2w3r C:346-462 [238903] Other proteins in same PDB: d2w3ra1, d2w3ra2, d2w3ra3, d2w3rb1, d2w3rb2, d2w3rc1, d2w3rc2, d2w3rc3, d2w3rd1, d2w3rd2, d2w3re1, d2w3re2, d2w3re3, d2w3rf1, d2w3rf2, d2w3rg1, d2w3rg2, d2w3rg3, d2w3rh1, d2w3rh2 automated match to d1jroa3 complexed with ca, fad, fes, hpa, mom, mte |
PDB Entry: 2w3r (more details), 2.9 Å
SCOPe Domain Sequences for d2w3rc4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w3rc4 d.87.2.0 (C:346-462) automated matches {Rhodobacter capsulatus [TaxId: 1061]} pglrcyklskrfdqdisavcgclnltlkgskietariafggmagvpkraaafeaaligqd fredtiaaalpllaqdftplsdmrasaayrmnaaqamalryvrelsgeavavlevmp
Timeline for d2w3rc4: