Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
Protein automated matches [191164] (21 species) not a true protein |
Species Rhodobacter capsulatus [TaxId:1061] [255635] (2 PDB entries) |
Domain d2w3rc1: 2w3r C:1-84 [238900] Other proteins in same PDB: d2w3ra2, d2w3ra3, d2w3ra4, d2w3rb1, d2w3rb2, d2w3rc2, d2w3rc3, d2w3rc4, d2w3rd1, d2w3rd2, d2w3re2, d2w3re3, d2w3re4, d2w3rf1, d2w3rf2, d2w3rg2, d2w3rg3, d2w3rg4, d2w3rh1, d2w3rh2 automated match to d1jroa2 complexed with ca, fad, fes, hpa, mom, mte |
PDB Entry: 2w3r (more details), 2.9 Å
SCOPe Domain Sequences for d2w3rc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w3rc1 d.15.4.0 (C:1-84) automated matches {Rhodobacter capsulatus [TaxId: 1061]} meiafllngetrrvriedptqsllewlraegltgtkegcnegdcgactvmirdaagsrav naclmmlpqiagkalrtiegiaap
Timeline for d2w3rc1: