Lineage for d2vyre_ (2vyr E:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1512787Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries)
  8. 1512845Domain d2vyre_: 2vyr E: [238892]
    Other proteins in same PDB: d2vyra_, d2vyrb_, d2vyrc_, d2vyrd_
    automated match to d2vyrf_
    complexed with so4

Details for d2vyre_

PDB Entry: 2vyr (more details), 2 Å

PDB Description: Structure of human MDM4 N-terminal domain bound to a single domain antibody
PDB Compounds: (E:) human single domain antibody

SCOPe Domain Sequences for d2vyre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vyre_ b.1.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqllesggglvqpggslrlscaasgftfeeyamlwvrqapgkglewvsginargyttyy
adsvkgrftisrdnskntlylqmnslrtedtavyycakpwypfmaskgsefdywgqgtlv
tvss

SCOPe Domain Coordinates for d2vyre_:

Click to download the PDB-style file with coordinates for d2vyre_.
(The format of our PDB-style files is described here.)

Timeline for d2vyre_: