Lineage for d2vx2i_ (2vx2 I:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2853751Species Human (Homo sapiens) [TaxId:9606] [226449] (5 PDB entries)
  8. 2853760Domain d2vx2i_: 2vx2 I: [238891]
    automated match to d2vx2a_

Details for d2vx2i_

PDB Entry: 2vx2 (more details), 2.3 Å

PDB Description: crystal structure of human enoyl coenzyme a hydratase domain-containing protein 3 (echdc3)
PDB Compounds: (I:) enoyl-coa hydratase domain-containing protein 3

SCOPe Domain Sequences for d2vx2i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vx2i_ c.14.1.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rptsarqldgirnivlsnpkkrntlslamlkslqsdilhdadsndlkviiisaegpvfss
ghdlkelteeqgrdyhaevfqtcskvmmhirnhpvpviamvnglataagcqlvascdiav
asdkssfatpgvnvglfcstpgvalaravprkvalemlftgepisaqeallhgllskvvp
eaelqeetmriarkiaslsrpvvslgkatfykqlpqdlgtayyltsqamvdnlalrdgqe
gitaflqkrkpvws

SCOPe Domain Coordinates for d2vx2i_:

Click to download the PDB-style file with coordinates for d2vx2i_.
(The format of our PDB-style files is described here.)

Timeline for d2vx2i_: