![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
![]() | Protein automated matches [190396] (40 species) not a true protein |
![]() | Species Human immunodeficiency virus 1 [TaxId:11676] [225129] (16 PDB entries) |
![]() | Domain d2vg6a2: 2vg6 A:430-551 [238890] Other proteins in same PDB: d2vg6a1, d2vg6b_ automated match to d2ykna2 protein/DNA complex; protein/RNA complex; complexed with nnb |
PDB Entry: 2vg6 (more details), 3.01 Å
SCOPe Domain Sequences for d2vg6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vg6a2 c.55.3.0 (A:430-551) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd kl
Timeline for d2vg6a2: