SCOPe 2.08: Domain d2vg6a2: 2vg6 A:430-551

Lineage for d2vg6a2 (2vg6 A:430-551)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [225129] (16 PDB entries)

8. Domain d2vg6a2: 2vg6 A:430-551 [238890]
   Other proteins in same PDB: d2vg6a1, d2vg6b_
   automated match to d2ykna2
   protein/DNA complex; protein/RNA complex; complexed with nnb

Details for d2vg6a2

PDB Entry: 2vg6, 3.01 Å

PDB Description: crystal structures of hiv-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d2vg6a2:

Sequence; same for both SEQRES and ATOM records:

>d2vg6a2 c.55.3.0 (A:430-551) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
kl

Timeline for d2vg6a2:

• d2vg6a2 first appeared in SCOPe 2.04
  
• d2vg6a2 appears in SCOPe 2.07