Lineage for d2vc2l2 (2vc2 L:108-214)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517994Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)
  8. 1518300Domain d2vc2l2: 2vc2 L:108-214 [238887]
    Other proteins in same PDB: d2vc2a_, d2vc2h1, d2vc2l1
    automated match to d1tqbc2
    complexed with 180, ca, gol, mg, nag

Details for d2vc2l2

PDB Entry: 2vc2 (more details), 3.1 Å

PDB Description: re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist l-739758
PDB Compounds: (L:) monoclonal antibody 10e5 light chain

SCOPe Domain Sequences for d2vc2l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vc2l2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d2vc2l2:

Click to download the PDB-style file with coordinates for d2vc2l2.
(The format of our PDB-style files is described here.)

Timeline for d2vc2l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vc2l1