SCOPe 2.04: Domain d2vc2l1: 2vc2 L:1-107

Lineage for d2vc2l1 (2vc2 L:1-107)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d2vc2l1: 2vc2 L:1-107 [238886]
   Other proteins in same PDB: d2vc2a_, d2vc2h1, d2vc2l2
   automated match to d1a5fl1
   complexed with 180, ca, gol, mg, nag

Details for d2vc2l1

PDB Entry: 2vc2, 3.1 Å

PDB Description: re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist l-739758

PDB Compounds: (L:) monoclonal antibody 10e5 light chain

SCOPe Domain Sequences for d2vc2l1:

Sequence; same for both SEQRES and ATOM records:

>d2vc2l1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleik

Timeline for d2vc2l1:

• d2vc2l1 is new in SCOPe 2.04-stable
  
• d2vc2l1 appears in SCOPe 2.05
  
• d2vc2l1 appears in the current release, SCOPe 2.08