Lineage for d2vc2a_ (2vc2 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2809519Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) (S)
  5. 2809520Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 proteins)
  6. 2809521Protein Integrin alpha N-terminal domain [69320] (2 species)
  7. 2809522Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (27 PDB entries)
    Uniprot P08514 32-483
  8. 2809552Domain d2vc2a_: 2vc2 A: [238885]
    Other proteins in same PDB: d2vc2h_, d2vc2l1, d2vc2l2
    automated match to d1tyea_
    complexed with 180, ca, gol, mg, nag

Details for d2vc2a_

PDB Entry: 2vc2 (more details), 3.1 Å

PDB Description: re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist l-739758
PDB Compounds: (A:) integrin alpha-IIb

SCOPe Domain Sequences for d2vc2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vc2a_ b.69.8.1 (A:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb [TaxId: 9606]}
lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng
dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
lrgavdiddngypdlivgayganqvavyraqp

SCOPe Domain Coordinates for d2vc2a_:

Click to download the PDB-style file with coordinates for d2vc2a_.
(The format of our PDB-style files is described here.)

Timeline for d2vc2a_: