Lineage for d2v2ta2 (2v2t A:278-378)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2376005Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2376006Protein automated matches [190226] (72 species)
    not a true protein
  7. 2376282Species Mouse (Mus musculus) [TaxId:10090] [226768] (5 PDB entries)
  8. 2376292Domain d2v2ta2: 2v2t A:278-378 [238873]
    Other proteins in same PDB: d2v2ta1, d2v2tb2
    automated match to d1gjia1
    protein/DNA complex

Details for d2v2ta2

PDB Entry: 2v2t (more details), 3.05 Å

PDB Description: x-ray structure of a nf-kb p50-relb-dna complex
PDB Compounds: (A:) transcription factor relb

SCOPe Domain Sequences for d2v2ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v2ta2 b.1.18.0 (A:278-378) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tselricrinkesgpctggeelyllcdkvqkedisvvfstaswegradfsqadvhrqiai
vfktppyedleisepvtvnvflqrltdgvcseplpftylpr

SCOPe Domain Coordinates for d2v2ta2:

Click to download the PDB-style file with coordinates for d2v2ta2.
(The format of our PDB-style files is described here.)

Timeline for d2v2ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v2ta1