SCOPe 2.08: Domain d2v2ta1: 2v2t A:100-277

Lineage for d2v2ta1 (2v2t A:100-277)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.0: automated matches [254271] (1 protein)
   not a true family

6. Protein automated matches [254628] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255599] (1 PDB entry)

8. Domain d2v2ta1: 2v2t A:100-277 [238872]
   Other proteins in same PDB: d2v2ta2, d2v2tb1, d2v2tb2
   automated match to d1gjia2
   protein/DNA complex

Details for d2v2ta1

PDB Entry: 2v2t, 3.05 Å

PDB Description: x-ray structure of a nf-kb p50-relb-dna complex

PDB Compounds: (A:) transcription factor relb

SCOPe Domain Sequences for d2v2ta1:

Sequence; same for both SEQRES and ATOM records:

>d2v2ta1 b.2.5.0 (A:100-277) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
cprpylviteqpkqrgmrfryecegrsagsilgessteasktqpaielrdcgglrevevt
aclvwkdwphrvhphslvgkdctdgvcrvrlrphvsprhsfnnlgiqcvrkkeieaaier
kiqlgidpynagslknhqevdmnvvricfqasyrdqqghlhrmdpilsepvydkkstn

Timeline for d2v2ta1:

• d2v2ta1 first appeared in SCOPe 2.04
  
• d2v2ta1 appears in SCOPe 2.07