Lineage for d2uumr_ (2uum R:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1718119Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1718294Protein automated matches [190531] (16 species)
    not a true protein
  7. 1718423Species Spirulina sp. [TaxId:1157] [255593] (1 PDB entry)
  8. 1718432Domain d2uumr_: 2uum R: [238867]
    Other proteins in same PDB: d2uuma_, d2uumc_, d2uume_, d2uumg_, d2uumi_, d2uumk_, d2uumm_, d2uumo_, d2uumq_, d2uums_, d2uumu_, d2uumw_
    automated match to d1ha7b_
    complexed with bla, cyc

Details for d2uumr_

PDB Entry: 2uum (more details), 3 Å

PDB Description: crystal structure of c-phycocyanin from phormidium, lyngbya spp. (marine) and spirulina sp. (fresh water) shows two different ways of energy transfer between two hexamers.
PDB Compounds: (R:) C-phycocyanin beta chain

SCOPe Domain Sequences for d2uumr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uumr_ a.1.1.3 (R:) automated matches {Spirulina sp. [TaxId: 1157]}
mfdaftkvvsqadtrgemlstaqidalsqmvaesnkrldvvnritsnastivsnaarslf
aeqpqliapggnaytstrmaaclrdmeiilryvtyavfagdasvledrclnglretylal
gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiasyfdracaavs

SCOPe Domain Coordinates for d2uumr_:

Click to download the PDB-style file with coordinates for d2uumr_.
(The format of our PDB-style files is described here.)

Timeline for d2uumr_: