Lineage for d2uuml_ (2uum L:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1475382Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1475551Protein automated matches [190531] (15 species)
    not a true protein
  7. 1475669Species Spirulina sp. [TaxId:1157] [255593] (1 PDB entry)
  8. 1475675Domain d2uuml_: 2uum L: [238864]
    Other proteins in same PDB: d2uuma_, d2uumc_, d2uume_, d2uumg_, d2uumi_, d2uumk_, d2uumm_, d2uumo_, d2uumq_, d2uums_, d2uumu_, d2uumw_
    automated match to d1ha7b_
    complexed with bla, cyc

Details for d2uuml_

PDB Entry: 2uum (more details), 3 Å

PDB Description: crystal structure of c-phycocyanin from phormidium, lyngbya spp. (marine) and spirulina sp. (fresh water) shows two different ways of energy transfer between two hexamers.
PDB Compounds: (L:) C-phycocyanin beta chain

SCOPe Domain Sequences for d2uuml_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uuml_ a.1.1.3 (L:) automated matches {Spirulina sp. [TaxId: 1157]}
mfdaftkvvsqadtrgemlstaqidalsqmvaesnkrldvvnritsnastivsnaarslf
aeqpqliapggnaytstrmaaclrdmeiilryvtyavfagdasvledrclnglretylal
gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiasyfdracaavs

SCOPe Domain Coordinates for d2uuml_:

Click to download the PDB-style file with coordinates for d2uuml_.
(The format of our PDB-style files is described here.)

Timeline for d2uuml_: