Lineage for d2uumd_ (2uum D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2302308Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2302507Protein automated matches [190531] (20 species)
    not a true protein
  7. 2302773Species Spirulina sp. [TaxId:1157] [255593] (1 PDB entry)
  8. 2302775Domain d2uumd_: 2uum D: [238860]
    Other proteins in same PDB: d2uuma_, d2uumc_, d2uume_, d2uumg_, d2uumi_, d2uumk_, d2uumm_, d2uumo_, d2uumq_, d2uums_, d2uumu_, d2uumw_
    automated match to d1ha7b_
    complexed with bla, cyc

Details for d2uumd_

PDB Entry: 2uum (more details), 3 Å

PDB Description: crystal structure of c-phycocyanin from phormidium, lyngbya spp. (marine) and spirulina sp. (fresh water) shows two different ways of energy transfer between two hexamers.
PDB Compounds: (D:) C-phycocyanin beta chain

SCOPe Domain Sequences for d2uumd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uumd_ a.1.1.3 (D:) automated matches {Spirulina sp. [TaxId: 1157]}
mfdaftkvvsqadtrgemlstaqidalsqmvaesnkrldvvnritsnastivsnaarslf
aeqpqliapggnaytstrmaaclrdmeiilryvtyavfagdasvledrclnglretylal
gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiasyfdracaavs

SCOPe Domain Coordinates for d2uumd_:

Click to download the PDB-style file with coordinates for d2uumd_.
(The format of our PDB-style files is described here.)

Timeline for d2uumd_: