Lineage for d2rfub_ (2rfu B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969580Protein Influenza hemagglutinin (stalk) [58066] (8 species)
    trimer
  7. 1969932Species Influenza b virus (strain b/hong kong/8/73) [TaxId:11531] [255583] (2 PDB entries)
  8. 1969934Domain d2rfub_: 2rfu B: [238858]
    Other proteins in same PDB: d2rfua_
    automated match to d1ti8b1
    complexed with nag

Details for d2rfub_

PDB Entry: 2rfu (more details), 2.8 Å

PDB Description: crystal structure of influenza b virus hemagglutinin in complex with lstc receptor analog
PDB Compounds: (B:) Influenza B hemagglutinin (HA)

SCOPe Domain Sequences for d2rfub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rfub_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza b virus (strain b/hong kong/8/73) [TaxId: 11531]}
gffgaiagfleggwegmiagwhgytshgahgvavaadlkstqeainkitknlnslselev
knlqrlsgamdelhneileldekvddlradtissqielavllsnegiinsedehllaler
klkkmlgpsavdigngcfetkhkcnqtcldriaagtfnagefslptfds

SCOPe Domain Coordinates for d2rfub_:

Click to download the PDB-style file with coordinates for d2rfub_.
(The format of our PDB-style files is described here.)

Timeline for d2rfub_: