Lineage for d2r2vb_ (2r2v B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039471Superfamily h.1.3: Leucine zipper domain [57959] (2 families) (S)
  5. 3039472Family h.1.3.1: Leucine zipper domain [57960] (17 proteins)
  6. 3039540Protein GCN4 [57961] (2 species)
  7. 3039541Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (65 PDB entries)
    Uniprot P03069 249-279 ! Uniprot P03069 249-281
  8. 3039581Domain d2r2vb_: 2r2v B: [238843]
    automated match to d2ccna1
    complexed with act, cit, zn

Details for d2r2vb_

PDB Entry: 2r2v (more details), 1.9 Å

PDB Description: Sequence Determinants of the Topology of the Lac Repressor Tetrameric Coiled Coil
PDB Compounds: (B:) GCN4 leucine zipper

SCOPe Domain Sequences for d2r2vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r2vb_ h.1.3.1 (B:) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mklkqvadkleevasklyhnanelarvakllge

SCOPe Domain Coordinates for d2r2vb_:

Click to download the PDB-style file with coordinates for d2r2vb_.
(The format of our PDB-style files is described here.)

Timeline for d2r2vb_: