Lineage for d1d4vb_ (1d4v B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1117451Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1117452Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1117453Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 1117478Protein Apoptosis-2 ligand, apo2l/TRAIL [49851] (1 species)
  7. 1117479Species Human (Homo sapiens) [TaxId:9606] [49852] (5 PDB entries)
  8. 1117481Domain d1d4vb_: 1d4v B: [23884]
    Other proteins in same PDB: d1d4va1, d1d4va2, d1d4va3

Details for d1d4vb_

PDB Entry: 1d4v (more details), 2.2 Å

PDB Description: crystal structure of trail-dr5 complex
PDB Compounds: (B:) tnf-related apoptosis inducing ligand

SCOPe Domain Sequences for d1d4vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d4vb_ b.22.1.1 (B:) Apoptosis-2 ligand, apo2l/TRAIL {Human (Homo sapiens) [TaxId: 9606]}
pqrvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrngelvihe
kgfyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeyg
lysiyqggifelkendrifvsvtnehlidmdheasffgaflvg

SCOPe Domain Coordinates for d1d4vb_:

Click to download the PDB-style file with coordinates for d1d4vb_.
(The format of our PDB-style files is described here.)

Timeline for d1d4vb_: