SCOPe 2.05: Domain d2qy0a1: 2qy0 A:290-357

Lineage for d2qy0a1 (2qy0 A:290-357)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein automated matches [254612] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255501] (4 PDB entries)

8. Domain d2qy0a1: 2qy0 A:290-357 [238838]
   Other proteins in same PDB: d2qy0b_, d2qy0d_
   automated match to d1gpza2
   complexed with gol

Details for d2qy0a1

PDB Entry: 2qy0, 2.6 Å

PDB Description: Active dimeric structure of the catalytic domain of C1r reveals enzyme-product like contacts

PDB Compounds: (A:) Complement C1r subcomponent

SCOPe Domain Sequences for d2qy0a1:

Sequence; same for both SEQRES and ATOM records:

>d2qy0a1 g.18.1.1 (A:290-357) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qacpqpktldeftiiqnlqpqyqfrdyfiatckqgyqliegnqvlhsftavcqddgtwhr
amprckik

Timeline for d2qy0a1:

• d2qy0a1 first appeared in SCOPe 2.04
  
• d2qy0a1 appears in SCOPe 2.06
  
• d2qy0a1 appears in the current release, SCOPe 2.08