Lineage for d2qree2 (2qre E:182-316)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901515Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 1901516Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 1901517Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 1901643Protein automated matches [190627] (6 species)
    not a true protein
  7. 1901644Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [231218] (4 PDB entries)
  8. 1901658Domain d2qree2: 2qre E:182-316 [238835]
    Other proteins in same PDB: d2qrea_, d2qreb_, d2qrec_, d2qred_
    automated match to d2ooxe2
    complexed with amz

Details for d2qree2

PDB Entry: 2qre (more details), 3.01 Å

PDB Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase in complex with 5-aminoimidazole-4-carboxamide 1-beta-D-ribofuranotide (ZMP)
PDB Compounds: (E:) Protein C1556.08c

SCOPe Domain Sequences for d2qree2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qree2 d.37.1.1 (E:182-316) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
vplnqmtigtwsnlatasmetkvydvikmlaeknisavpivnsegtllnvyesvdvmhli
qdgdysnldlsvgeallkrpanfdgvhtcratdrldgifdaikhsrvhrlfvvdenlkle
gilsladilnyiiyd

SCOPe Domain Coordinates for d2qree2:

Click to download the PDB-style file with coordinates for d2qree2.
(The format of our PDB-style files is described here.)

Timeline for d2qree2: