Class g: Small proteins [56992] (98 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) |
Family g.3.13.0: automated matches [254212] (1 protein) not a true family |
Protein automated matches [254478] (3 species) not a true protein |
Species Oryza sativa [TaxId:39947] [255570] (1 PDB entry) |
Domain d2qn5b2: 2qn5 B:69-131 [238833] Other proteins in same PDB: d2qn5t_ automated match to d1c2aa1 |
PDB Entry: 2qn5 (more details), 3 Å
SCOPe Domain Sequences for d2qn5b2:
Sequence, based on SEQRES records: (download)
>d2qn5b2 g.3.13.0 (B:69-131) automated matches {Oryza sativa [TaxId: 39947]} prpwgdccdkafcnkmnpptcrcmdevkecadackdcqrvesseppryvckdrftghpgp vck
>d2qn5b2 g.3.13.0 (B:69-131) automated matches {Oryza sativa [TaxId: 39947]} prpwgdccdkafcnkmnpptcrcvkecadackdcqrvesseckdrftghpgpvck
Timeline for d2qn5b2: