![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) ![]() |
![]() | Family g.3.13.0: automated matches [254212] (1 protein) not a true family |
![]() | Protein automated matches [254478] (3 species) not a true protein |
![]() | Species Oryza sativa [TaxId:39947] [255570] (1 PDB entry) |
![]() | Domain d2qn5b1: 2qn5 B:1-68 [238832] Other proteins in same PDB: d2qn5t_ automated match to d1c2aa1 |
PDB Entry: 2qn5 (more details), 3 Å
SCOPe Domain Sequences for d2qn5b1:
Sequence, based on SEQRES records: (download)
>d2qn5b1 g.3.13.0 (B:1-68) automated matches {Oryza sativa [TaxId: 39947]} merpwkccdnikrlptkpdppqwrcndelepsqctaackscreapgpfpgklicediywg adpgpfct
>d2qn5b1 g.3.13.0 (B:1-68) automated matches {Oryza sativa [TaxId: 39947]} merpwkccdnikrlptkpdppqwrcndelepsqcckscricediywgadpgpfct
Timeline for d2qn5b1: