SCOPe 2.07: Domain d2qn5b1: 2qn5 B:1-68

Lineage for d2qn5b1 (2qn5 B:1-68)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families)

5. Family g.3.13.0: automated matches [254212] (1 protein)
   not a true family

6. Protein automated matches [254478] (3 species)
   not a true protein

7. Species Oryza sativa [TaxId:39947] [255570] (1 PDB entry)

8. Domain d2qn5b1: 2qn5 B:1-68 [238832]
   Other proteins in same PDB: d2qn5t_
   automated match to d1c2aa1

Details for d2qn5b1

PDB Entry: 2qn5, 3 Å

PDB Description: Crystal Structure and Functional Study of the Bowman-Birk Inhibitor from Rice Bran in Complex with Bovine Trypsin

PDB Compounds: (B:) Bowman-Birk type bran trypsin inhibitor

SCOPe Domain Sequences for d2qn5b1:

Sequence, based on SEQRES records:

>d2qn5b1 g.3.13.0 (B:1-68) automated matches {Oryza sativa [TaxId: 39947]}
merpwkccdnikrlptkpdppqwrcndelepsqctaackscreapgpfpgklicediywg
adpgpfct

Sequence, based on observed residues (ATOM records):

>d2qn5b1 g.3.13.0 (B:1-68) automated matches {Oryza sativa [TaxId: 39947]}
merpwkccdnikrlptkpdppqwrcndelepsqcckscricediywgadpgpfct

Timeline for d2qn5b1:

• d2qn5b1 first appeared in SCOPe 2.04
  
• d2qn5b1 appears in SCOPe 2.06
  
• d2qn5b1 appears in the current release, SCOPe 2.08