Lineage for d2qn5b1 (2qn5 B:1-68)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1700389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1701956Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) (S)
  5. 1701995Family g.3.13.0: automated matches [254212] (1 protein)
    not a true family
  6. 1701996Protein automated matches [254478] (2 species)
    not a true protein
  7. 1701999Species Oryza sativa [TaxId:39947] [255570] (1 PDB entry)
  8. 1702000Domain d2qn5b1: 2qn5 B:1-68 [238832]
    Other proteins in same PDB: d2qn5t_
    automated match to d1c2aa1

Details for d2qn5b1

PDB Entry: 2qn5 (more details), 3 Å

PDB Description: Crystal Structure and Functional Study of the Bowman-Birk Inhibitor from Rice Bran in Complex with Bovine Trypsin
PDB Compounds: (B:) Bowman-Birk type bran trypsin inhibitor

SCOPe Domain Sequences for d2qn5b1:

Sequence, based on SEQRES records: (download)

>d2qn5b1 g.3.13.0 (B:1-68) automated matches {Oryza sativa [TaxId: 39947]}
merpwkccdnikrlptkpdppqwrcndelepsqctaackscreapgpfpgklicediywg
adpgpfct

Sequence, based on observed residues (ATOM records): (download)

>d2qn5b1 g.3.13.0 (B:1-68) automated matches {Oryza sativa [TaxId: 39947]}
merpwkccdnikrlptkpdppqwrcndelepsqcckscricediywgadpgpfct

SCOPe Domain Coordinates for d2qn5b1:

Click to download the PDB-style file with coordinates for d2qn5b1.
(The format of our PDB-style files is described here.)

Timeline for d2qn5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qn5b2
View in 3D
Domains from other chains:
(mouse over for more information)
d2qn5t_