Lineage for d2qjad_ (2qja D:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259038Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2259039Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2259269Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 2259270Protein BMP receptor Ia ectodomain [57359] (1 species)
  7. 2259271Species Human (Homo sapiens) [TaxId:9606] [57360] (11 PDB entries)
  8. 2259285Domain d2qjad_: 2qja D: [238829]
    Other proteins in same PDB: d2qjaa_, d2qjab_
    automated match to d3qb4d_

Details for d2qjad_

PDB Entry: 2qja (more details), 2.6 Å

PDB Description: crystal structure analysis of bmp-2 in complex with bmpr-ia variant b12
PDB Compounds: (D:) Bone morphogenetic protein receptor type IA

SCOPe Domain Sequences for d2qjad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qjad_ g.7.1.3 (D:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
dtlpflkcycsghcpddainntcitnghcfaiieeddqgettltsgclglegsdfqcrdt
piphqrrsieccrtnlcnqylqptlppvvigpf

SCOPe Domain Coordinates for d2qjad_:

Click to download the PDB-style file with coordinates for d2qjad_.
(The format of our PDB-style files is described here.)

Timeline for d2qjad_: